Live chat

boboviz No, molto interessante. (22.06.22, 12:48)
valterc conoscete? https://swag.thesciencecommons.org/ (22.06.22, 11:44)
Nubman Peccato, su Moo! Wrapper siamo forti (valterc è forte ) https://formula-boinc.org/forum/viewtopic.php?p=2863#p2863 https://www.boincstats.com/stats/114/user/list/12/0/1108 (20.06.22, 09:09)
Spot T Sprint FB su Moo! Wrapper... boh... (18.06.22, 09:41)
Nubman Sprint Formula BOINC sul LHC@home: 09/06/2022 19:00 (UTC) - 12/06/2022 18:59 (UTC) (10.06.22, 18:32)
sabayonino https://sostieni.legambiente.it/page/103795/donate/1 (08.06.22, 18:05)
boboviz risolto (01.06.22, 12:04)
boboviz oggi lo ricontrollo, grazie Nub (31.05.22, 11:53)
boboviz urca (31.05.22, 11:53)
Nubman Il link ai sorgenti del progetto The Ramanujan Machine è sbagliato (c'è il nome del progetto insieme all'url) @staff (31.05.22, 11:40)
Antonio Cerrato con il nuovo progetto dell'AIRC, quello del covid sembra girare bene (31.05.22, 11:26)
Antonio Cerrato l'app di dreamlab non si apre più oppure mi segna 600 ore con 0 calcoli (intanto questa mattina ho avvisato la pagina instagram dell'airc del nuovo progetto) (31.05.22, 11:15)
Nubman Avrebbero dovuto lasciare il Formula BOINC così com'era negli anni precedenti (29.05.22, 09:50)
zioriga formula boinc è partito ieri sera alle 23:00 con il progetto PrimeGrid, ma le statistiche sono ferme a zero (27.05.22, 08:13)
valterc boh, apro un thread... (24.05.22, 16:57)
boboviz Certo! (24.05.22, 16:44)
valterc secondo voi avrebbe senso cercare di organizzare un meeting tra di noi? (24.05.22, 16:04)
Buro87 Domani dovrebbe riprendere WCG (23.05.22, 11:36)
Antonio Cerrato complimenti a tutti! (19.05.22, 15:53)
sabayonino @Nub : c'è anche il certificato del sito della classifica scaduto a quanto pare (19.05.22, 12:39)
Per usare la chat devi effettuare il login.
Benvenuto, Ospite
Nome utente: Password: Ricordami

Supporta BOINC.Italy con una piccola donazione
Leggi tutto...

ARGOMENTO:

[Thread Ufficiale] SIMAP 10/01/2008 19:40 #757

  • morse
  • Avatar di morse Autore della discussione
  • Offline
  • Administrator
  • Administrator
  • Messaggi: 9196
  • Ringraziamenti ricevuti 3



Link utili:

Articolo di approfondimento sul portale
Indirizzo per connettersi al progetto: boincsimap.org/boincsimap (da selezionare nel Boinc Manager)
Link per effettuare il Join a BOINC.Italy
PC1: Intel Q9400 2.66 GHz, ASUS P5KC, nVidia GeForce 9400GT (smontata al momento), ATI HD5850, maxtor 250 GB, 4 GB ram Kingston.
PC2: Intel E8400 3.0 GHz, ASROCK G31M-GS, 2 GB ram Kingston, maxtor 80 GB, nVidia GTX275





http://stats.free-dc.org/badges.php?proj=yoy&id=17281&rows=1
Ultima Modifica: da baxnimis.
L\'Argomento è stato bloccato.

Re:SIMAP 10/01/2008 19:48 #759

  • morse
  • Avatar di morse Autore della discussione
  • Offline
  • Administrator
  • Administrator
  • Messaggi: 9196
  • Ringraziamenti ricevuti 3
Frequently asked questions:

Qual'è la differenza tra le applicazioni Simap e Hmmer?

Entrambe le applicazioni analizzano le sequenze di proteine in SIMAP. Mentre l'applicazione Simap calcola le somiglianze tra le sequenze utilizzando l'algoritmo FASTA, Hmmer (si può pronunciare come "Hammer" ) ricerca i settori delle proteine, descritti matematicamente attraverso il Modello Nascosto di Markov, dentro le sequenze provenienti da SIMAP. Leggi la descrizione del nostro progetto per avere un'idea di come siano utilizzati i loro risultati.

Devo riconfigurare il mio BOINC manager se il progetto BOINCSIMAP cambia tra workunits hmmer e simap?

No. Il tuo client BOINC passa automaticamente all'applicazione appropriata se cambiano le workunits da BOINCSIMAP.

Di quanta potenza di calcolo necessiterà BOINCSIMAP in futuro?

Ci sono due sottoprogetti, rappresentati da due applicazioni: il calcolo similare non necessita più dell'intera potenza di calcolo del progetto BOINCSIMAP, poichè tutto l'arretrato del 2005/2006 (causato da aggiornamenti ed ingrandimento) potrebbe essere calcolato fino al settembre 2006. Il secondo sottoprogetto - il pre-calcolo dei settori delle proteine - richiederà molta più potenza di calcolo poichè è stato calcolato solamente un piccolo set di dati. Per il 2007 noi aspettiamo di avere abbastanza lavoro per hmmer per utilizzare la totale potenza di calcolo di BOINCSIMAP.

Perchè ho ottenuto più/meno crediti rispetto a quelli richiesti?


BOINCSIMAP ha implementato crediti specifici per workunit (chiamati anche "crediti fissati per workunit" ). Quindi i crediti che tu ottieni per risultati validi non sono calcolati dai crediti che il tuo client BOINC (ottimizzato o non) richiedeva, ma dall'ammontare di sequenze/modelli nella workunit (hmmer e simap) e dal numero di successi nel risultato (solo simap è dovuto da un costosa elaborazione di successi). Questo rende i crediti giusti e relativamente connessi alla potenza di calcolo che hai donato al nostro progetto. Poichè questa non è la via classica per assegnare i crediti nei progetti di BOINC, noi siamo disponibili per discussioni sui crediti specifici per workunit (per favore visita la nostra message board).

Il volume di download/upload può essere diminuito per gli utenti con poca larghezza di banda di internet?

Non proprio. Attualmente stiamo lavorando su una compressione 7zip delle workunits e dei risultati. Questo diminuirà gli up/download di una grande percentuale. Ma il volume di trasferimento dei dati è direttamente connesso alla tecnica di analisi della sequenza biologica. La cache locale non è un'opzione, poichè l'opportunità di ottenere parecchie workunits contenenti le stesse sequenze o modelli di settori è estremamente bassa. Quindi noi preferiremmo suggerire agli utenti con poca larghezza di banda di internet di limitare il progetto BOINCSIMAP nel BOINC manager ad una percentuale che è ancora accettabile per voi.

In quanto ai grafici per le applicazioni hmmer e simap?

Si, noi vogliamo implementare i grafici per le nostre applicazioni, ma fino ad ora non possiamo farlo perchè i (pochi) programmatori di C++ nel nostro team sono occupati con la parte funzionale delle applicazioni. Quindi pianifichiamo di fornire grafici statici (per una descrizione vedi le API grafiche di BOINC) che mostrano alcune informazioni sulla workunit attualmente in lavorazione.

Perchè non esistono delle applicazioni ottimizzate per il tipo xyz di CPU?

Attualmente il client BOINC non può selezionare un'applicazione basata su un tipo di CPU, ma sulle piattaforme più importanti. Quindi forniamo applicazioni per le piattaforme che sono tipicamente usate con i progetti di BOINC. Esistono discussioni in corso nella community degli sviluppatori di BOINC sul meccanismo di selezione dell'applicazione basato sul tipo di CPU. Non appena tale metodo sarà disponibile noi forniremo differenti applicazioni per i tipi più importanti di CPU.

Dove posso fare una domanda diversa o discutere un problema?


Nelle nostre message boards troverai altre FAQ e boards di discussione. Per favore sentiti libero di usarle attivamente. Scrivere nelle boards richiede un login separato, diverso dall'account di BOINC.

(Queste FAQ sono tratte dal sito del progetto. Naturalmente per porre qualsiasi altra domanda si può usare questa discussione)


Curiosità:
L'amministratore del forum di SIMAP ha messo in questa discussione boinc.bio.wzw.tum.de/boincsimap/forum/viewtopic.php?t=192 l'indirizzo dove si possono effettuare ricerche sulle proteine all'interno del database SIMAP e ha fornito la sequenza amminoacidica di una proteina per fare una prova di ricerca nel database.
Questo il sito: webclu.bio.wzw.tum.de/simap/web/simap/simpleSearch
Questa la sequenza: NNCPLDWLPMNGLCYKIFNQLKTWEDAEMFCRKYKPGCHLASFHRYGESLEIAEYISDYHKGQENVWIGLRDKKKDFSWE
WTDRSCTDYLTWDKNQPDHYQNKEFCVELVSLTGYRLWNDQVCESKDAFLCQCKF


Sempre sul forum sono presenti alcuni siti che fanno riferimento ai database delle varie organizzazioni. ( FORUM SIMAP ). Qui di seguito sono elencati alcuni di questi database:

www.rcsb.org
pcons.net/
www.uniprot.org/
www.pdb.org/
topmatch.services.came.sbg.ac.at/
robetta.bakerlab.org/queue.jsp


IN AGGIORNAMENTO
PC1: Intel Q9400 2.66 GHz, ASUS P5KC, nVidia GeForce 9400GT (smontata al momento), ATI HD5850, maxtor 250 GB, 4 GB ram Kingston.
PC2: Intel E8400 3.0 GHz, ASROCK G31M-GS, 2 GB ram Kingston, maxtor 80 GB, nVidia GTX275





http://stats.free-dc.org/badges.php?proj=yoy&id=17281&rows=1
Ultima Modifica: da morse.
L\'Argomento è stato bloccato.

Re:SIMAP 10/01/2008 19:57 #760

  • Venturini Dario
  • Avatar di Venturini Dario
  • Offline
  • RAM >4 GB
  • RAM >4 GB
  • Amministratore
  • Messaggi: 6596
  • Ringraziamenti ricevuti 1
Beh in realtà, se lo completi un pò (aggiungi qualche cosa, magari qualche approfondimento e/o link e/o quello che ti pare) direi che potrebbe benissimo essere il thread ufficiale. :king:

Magari guardati quello che ho fatto su LHC@Home (in particolare il secondo post, il resto l'ho aggiunto perchè mi piaceva)

Ah... dai un'occhiata anche al thread sulle traduzioni, magari non l'avevi visto... hai tradotto qualcosa che stava traducendo un altro utente
"A proton walks into a Large Hadron Collider, and sees another proton, and OH SHI-"

La Repubblica Italiana è fondata sul lavoro, quindi LAVORATE !
L\'Argomento è stato bloccato.

Re:SIMAP 10/01/2008 20:30 #762

  • 7D9
  • Avatar di 7D9
  • Offline
  • Ideatore del termosifone
  • Ideatore del termosifone
  • Messaggi: 1642
  • Ringraziamenti ricevuti 0
Ops..

Comunque io queste cose le avevo già tradotte da un pezzo su HWU..
L\'Argomento è stato bloccato.

Re:SIMAP 10/01/2008 22:08 #767

  • 7D9
  • Avatar di 7D9
  • Offline
  • Ideatore del termosifone
  • Ideatore del termosifone
  • Messaggi: 1642
  • Ringraziamenti ricevuti 0
Ho aggiunto alcune info seguendo il modello del thread di LHC.
Dovreste solo dirmi la lunghezza delle WUs perchè io è da un po' che non elaboro qui e non me le ricordo. Anche per lo screensaver non sono più tanto sicuro che non ci fosse.
Fatemi sapere.

Segnalate pure qualsiasi errore o richiesta, anche per quanto riguarda la traduzione. :)
L\'Argomento è stato bloccato.

Re:SIMAP 10/01/2008 23:49 #770

  • ricky_4
  • Avatar di ricky_4
  • Offline
  • RAM 128 KB
  • RAM 128 KB
  • Messaggi: 189
  • Ringraziamenti ricevuti 0
Venturini Dario ha scritto:

Beh in realtà, se lo completi un pò (aggiungi qualche cosa, magari qualche approfondimento e/o link e/o quello che ti pare) direi che potrebbe benissimo essere il thread ufficiale. :king:

Magari guardati quello che ho fatto su LHC@Home (in particolare il secondo post, il resto l'ho aggiunto perchè mi piaceva)

Ah... dai un'occhiata anche al thread sulle traduzioni, magari non l'avevi visto... hai tradotto qualcosa che stava traducendo un altro utente

era quello che stavo traducendo io vero? se si cambio traduzione, no problem... ;)
Knight di IV° livello -- Flotta Stellare su BOINC.Italy -- Vice-Admiral della sezione Advanced Starship Design Bureau
Il Mio Pc: Ali LC Power 550 W - Mobo ASUS P5KPL - Intel Core 2 Quad Q6600 @ 2.4 Ghz - Ram DdrII 4x1024Mb 800Mhz - SV nVidia GeForce 8800GTS 320Mb DdrIII
L\'Argomento è stato bloccato.

Re:SIMAP 10/01/2008 23:54 #772

  • GHz
  • Avatar di GHz
  • Offline
  • Administrator
  • Administrator
  • BOINC.Italy rulez!
  • Messaggi: 3281
  • Ringraziamenti ricevuti 17
Bel lavoro Manuel! :mano:

Per la durata delle wu anche io non ti so dare indicazione perchè è tanto che non ci scaccolo, dovresti sentire wubby, at o altri che ci partecipano molto, sicuramente loro sapranno darti informazioni dettagliate (anche per quanto riguarda linux).

Dimmi se vuoi fare da referente per questo progetto così ti metto il livello appropriato sul forum :D

Ciao,
GHz
SEI ITALIANO? :approve: SUPPORTA BOINC.ITALY! :italy:
L\'Argomento è stato bloccato.

Re:SIMAP 11/01/2008 01:22 #774

  • wubby
  • Avatar di wubby
  • Visitatori
  • Visitatori
GHz ha scritto:

Bel lavoro Manuel! :mano:


Si, bel lavoro!!! :cincin:

Per la durata delle wu anche io non ti so dare indicazione perchè è tanto che non ci scaccolo, dovresti sentire wubby, at o altri che ci partecipano molto, sicuramente loro sapranno darti informazioni dettagliate (anche per quanto riguarda linux).


:frusta: Ho smesso di scaccolare su SIMAP da un po' di tempo...
L\'Argomento è stato bloccato.

Re:SIMAP 11/01/2008 14:01 #797

  • morse
  • Avatar di morse Autore della discussione
  • Offline
  • Administrator
  • Administrator
  • Messaggi: 9196
  • Ringraziamenti ricevuti 3
Io, con il mio Athlon Xp 2600+ (e poi c'è della gente che dice che è vecchio il suo Athlon 64 :arg:) le wu con il client simap@home 5.10 le completo, in media, in 1h e 25min.

Ho notato però che in base al batch di wu il tempo di elaborazione può variare di + o - di 15 min da quello che ho scritto sopra.


Andrea, :)
PC1: Intel Q9400 2.66 GHz, ASUS P5KC, nVidia GeForce 9400GT (smontata al momento), ATI HD5850, maxtor 250 GB, 4 GB ram Kingston.
PC2: Intel E8400 3.0 GHz, ASROCK G31M-GS, 2 GB ram Kingston, maxtor 80 GB, nVidia GTX275





http://stats.free-dc.org/badges.php?proj=yoy&id=17281&rows=1
L\'Argomento è stato bloccato.

Re:SIMAP 13/01/2008 21:56 #867

  • 7D9
  • Avatar di 7D9
  • Offline
  • Ideatore del termosifone
  • Ideatore del termosifone
  • Messaggi: 1642
  • Ringraziamenti ricevuti 0
GHz ha scritto:

Dimmi se vuoi fare da referente per questo progetto così ti metto il livello appropriato sul forum :D


Per fare da referente ci devo pensare.. Perché ci sono dei periodi in cui sono totalmente assente e non potrei seguire il forum.

Quello che è certo è che voglio la qualifica di "creatore del Termosifone" :D


@ morse: ho aggiunto il tuo tempo e anche quello del mio portatile. Grazie. :)
L\'Argomento è stato bloccato.

Re:SIMAP 13/01/2008 23:34 #870

  • morse
  • Avatar di morse Autore della discussione
  • Offline
  • Administrator
  • Administrator
  • Messaggi: 9196
  • Ringraziamenti ricevuti 3
7D9 ha scritto:


@ morse: ho aggiunto il tuo tempo e anche quello del mio portatile. Grazie. :)[/quote]


Di niente, se posso aiutare, entro le mie possibilità, il portale lo faccio volentieri.


Andrea, :)
PC1: Intel Q9400 2.66 GHz, ASUS P5KC, nVidia GeForce 9400GT (smontata al momento), ATI HD5850, maxtor 250 GB, 4 GB ram Kingston.
PC2: Intel E8400 3.0 GHz, ASROCK G31M-GS, 2 GB ram Kingston, maxtor 80 GB, nVidia GTX275





http://stats.free-dc.org/badges.php?proj=yoy&id=17281&rows=1
L\'Argomento è stato bloccato.

Re:SIMAP 21/01/2008 21:14 #1168

  • 7D9
  • Avatar di 7D9
  • Offline
  • Ideatore del termosifone
  • Ideatore del termosifone
  • Messaggi: 1642
  • Ringraziamenti ricevuti 0
Ho aggiornato il primo post con le FAQ. Se ci sono errori segnalateli.

Grazie a ricky_4 per averle tradotte. :winner: :mano:
L\'Argomento è stato bloccato.

Re:SIMAP 21/01/2008 23:16 #1174

  • GHz
  • Avatar di GHz
  • Offline
  • Administrator
  • Administrator
  • BOINC.Italy rulez!
  • Messaggi: 3281
  • Ringraziamenti ricevuti 17
7D9 ha scritto:

GHz ha scritto:

Dimmi se vuoi fare da referente per questo progetto così ti metto il livello appropriato sul forum :D


Per fare da referente ci devo pensare.. Perché ci sono dei periodi in cui sono totalmente assente e non potrei seguire il forum.

Quello che è certo è che voglio la qualifica di "creatore del Termosifone" :D


Fatto :O :D :asd:

Fammi sapere poi cosa hai deciso per il referente ;)

7D9 ha scritto:

Ho aggiornato il primo post con le FAQ. Se ci sono errori segnalateli.

Grazie a ricky_4 per averle tradotte. :winner: :mano:


Ottimo! Per quanto riguarda la disponibilità delle wu hai messo "buona" io direi di specificare in quel punto che le wu vengono distribuite a intervalli di tempo (solitamente all'inizio di ogni mese, i noti batch di wu) e quindi sono disponibili solo in periodi ristretti di tempo che solitamente durano pochi giorni.

Ciao,
GHz
SEI ITALIANO? :approve: SUPPORTA BOINC.ITALY! :italy:
L\'Argomento è stato bloccato.

Re:SIMAP 21/01/2008 23:41 #1177

  • ricky_4
  • Avatar di ricky_4
  • Offline
  • RAM 128 KB
  • RAM 128 KB
  • Messaggi: 189
  • Ringraziamenti ricevuti 0
7D9 ha scritto:

Ho aggiornato il primo post con le FAQ. Se ci sono errori segnalateli.

Grazie a ricky_4 per averle tradotte. :winner: :mano:

eheh prego, sempre disponibile per le traduzioni ;)
Knight di IV° livello -- Flotta Stellare su BOINC.Italy -- Vice-Admiral della sezione Advanced Starship Design Bureau
Il Mio Pc: Ali LC Power 550 W - Mobo ASUS P5KPL - Intel Core 2 Quad Q6600 @ 2.4 Ghz - Ram DdrII 4x1024Mb 800Mhz - SV nVidia GeForce 8800GTS 320Mb DdrIII
L\'Argomento è stato bloccato.

Re:SIMAP 22/01/2008 13:30 #1215

  • morse
  • Avatar di morse Autore della discussione
  • Offline
  • Administrator
  • Administrator
  • Messaggi: 9196
  • Ringraziamenti ricevuti 3
Cmq ultimamente simap rilascia dei batch che coprono abbondantemente tutto il mese. Io è da inizio novembre che scaccolo continuamente solo su simap.


Andrea, :)
PC1: Intel Q9400 2.66 GHz, ASUS P5KC, nVidia GeForce 9400GT (smontata al momento), ATI HD5850, maxtor 250 GB, 4 GB ram Kingston.
PC2: Intel E8400 3.0 GHz, ASROCK G31M-GS, 2 GB ram Kingston, maxtor 80 GB, nVidia GTX275





http://stats.free-dc.org/badges.php?proj=yoy&id=17281&rows=1
L\'Argomento è stato bloccato.

Re:SIMAP 22/01/2008 14:12 #1218

  • 7D9
  • Avatar di 7D9
  • Offline
  • Ideatore del termosifone
  • Ideatore del termosifone
  • Messaggi: 1642
  • Ringraziamenti ricevuti 0
@ GHz: va bene, faccio io il referente del progetto. Ma solo perchè mi hai dato la qualifica di creatore del termosifone. ;) :asd: :D

Per la disponibilità di WUs avevo messo buona perchè come ha fatto notare morse è da circa novembre che ci sono continuamente WUs disponibili.
In ogni caso aggiungerò questo dettaglio. :)
L\'Argomento è stato bloccato.

Re:SIMAP 27/01/2008 23:14 #1419

  • Effelle
  • Avatar di Effelle
  • Offline
  • RAM 128 KB
  • RAM 128 KB
  • Messaggi: 111
  • Ringraziamenti ricevuti 0
Mi è apparso questo messaggio, che non so ben capire.
dom 27 gen 2008 21:50:27 CET||[error] Proposed work request 124163.959908 bigger than max 74174.400000
Francesco
BOINCStats: statistiche per progetto (immagine)

GenuineIntel Intel(R) Core(TM)2 Quad CPU Q8200 @ 2.33GHz [Family 6 Model 23 Stepping 7] (4 processors), 4 GB RAM, NVIDIA GeForce 9800 GTX/9800 GTX+ (511MB), vari HD (SATA e EIDE), Sabayon-Linux-amd64-2.6.33
L\'Argomento è stato bloccato.

Re:SIMAP 28/01/2008 09:17 #1426

  • 7D9
  • Avatar di 7D9
  • Offline
  • Ideatore del termosifone
  • Ideatore del termosifone
  • Messaggi: 1642
  • Ringraziamenti ricevuti 0
Non avevo mai visto questo messaggio prima d'ora...

Ma il problema qual'è? Non ti scarica WUs?
L\'Argomento è stato bloccato.

Re:SIMAP 05/02/2008 21:14 #1852

  • 7D9
  • Avatar di 7D9
  • Offline
  • Ideatore del termosifone
  • Ideatore del termosifone
  • Messaggi: 1642
  • Ringraziamenti ricevuti 0
Curiosità:

L'amministratore del forum di SIMAP ha messo in questa discussione boinc.bio.wzw.tum.de/boincsimap/forum/viewtopic.php?t=192 l'indirizzo dove si possono effettuare ricerche sulle proteine all'interno del database SIMAP e ha fornito la sequenza amminoacidica di una proteina per fare una prova di ricerca nel database.
Questo il sito: webclu.bio.wzw.tum.de/simap/web/simap/simpleSearch
Questa la sequenza: NNCPLDWLPMNGLCYKIFNQLKTWEDAEMFCRKYKPGCHLASFHRYGESLEIAEYISDYHKGQENVWIGLRDKKKDFSWE
WTDRSCTDYLTWDKNQPDHYQNKEFCVELVSLTGYRLWNDQVCESKDAFLCQCKF

(aggiunto nel primo post) :D
L\'Argomento è stato bloccato.

Re:[Thread Ufficiale] SIMAP 15/02/2008 20:54 #2147

  • SickBoy88
  • Avatar di SickBoy88
  • Offline
  • RAM 512 KB
  • RAM 512 KB
  • Impossibile non è una regola, è una sfida!
  • Messaggi: 1860
  • Ringraziamenti ricevuti 0
Ho trovato sul sito di simap la pagina dove trovare i progressi del progetto. eccola:
boinc.bio.wzw.tum.de/boincsimap/batchmonitor.php
Non possiamo fare più finta di niente; al confronto dei politici siamo delle mezze seghe, dei conglomerati fecali simil cilindrici.
SVEGLIAAA!
Nelle auto blu ci sono più festini che nei nostri backstage, le loro intercettazioni sono più porche delle nostre interviste, persino le loro madri si vergognano più delle nostre. Loro sono delle eroiche puttane, delle superpotenze seminali e noi.. noi cosa siamo diventati? Ragazzette da sposare… Riprendiamoci i coma etilici, i fetori passionali, dirottiamo sull'edonismo e smettiamola di fare concerti per salvare le balene! Torniamo a passare l'inverno a scopare come ricci e l'estate a curarci le malattie veneree.
Solo così riusciremo a riprenderci ciò che è nostro o lasceremo a loro non solo il potere ma anche il Rock'N'Roll.
L\'Argomento è stato bloccato.
Moderatori: camposReLeon
Tempo creazione pagina: 0.253 secondi
Powered by Forum Kunena

Articoli

Written on 17/01/2022, 14:43 by boboviz
rosetta-e-virtualboxDa un po' di tempo il progetto Rosetta@Home sembra aver decisamente puntato sull’applicativo VirtualBox (Phyton), lasciando spesso vuote le code per gli...

Ultime dal Blog

Written on 03/08/2021, 22:27 by boboviz
foldit-e-alphafoldLa "svolta" AlphaFold è una delle più importanti degli ultimi anni, motivo per cui ho deciso di tradurre l'articolo che parla della sua implementazione in...